PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G209600.1
Common NamePHAVU_003G209600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Trihelix
Protein Properties Length: 871aa    MW: 96885.4 Da    PI: 8.7231
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G209600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix65.31.3e-20777858186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+++ev++Li +r em++r++  k +++lWee+s+++ + g++rsp qCk+ w +l ++y+++ ++ek++    ++++py++++e
  Phvul.003G209600.1 777 KWKHDEVKKLIGMRGEMNDRFQVVKGRMALWEEISQNLLSNGISRSPGQCKSLWTSLLQKYEQEVKNEKNG----KKKWPYLEEME 858
                         7********************************************************************97....568*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.8E-6878328IPR001279Metallo-beta-lactamase
SuperFamilySSF562816.71E-7279493IPR001279Metallo-beta-lactamase
SMARTSM008499.4E-2591288IPR001279Metallo-beta-lactamase
PfamPF127061.2E-10103238IPR001279Metallo-beta-lactamase
PfamPF075211.2E-6436465IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
PROSITE profilePS500908.142770834IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-4771836IPR009057Homeodomain-like
PfamPF138378.0E-17776860No hitNo description
CDDcd122031.16E-17780838No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 871 aa     Download sequence    Send to blast
MASCISLSLC PHTFCCRHRP YSTRRSLSCS LSSSSLLDTD GHKVLRKRSR RIEGPRKSME  60
DSVQRKMEEF YEGRDGPPLR VLPIGGLGEI GMNCMLVGNY DRYILIDAGI MFPDYDELGI  120
QKIIPDTTFI RKWRHKIEAV IITHGHEDHI GALPWVIPAL DSHTPIFASS FTMELIRKRL  180
KDHGIFVPSR LKVFRTRKKF MAGPFEIEPI TVTHSIPDCC GLVLRCSDGT ILHTGDWKID  240
ETPLDGKVFD REALEELSKE GVTLMMSDST NVLSPGRTTS ESIVADALLR NISAAKGRVI  300
TTQFASNIHR LGSVKAAADS SGRKLVFVGM SLRTYLDAAW KDGKAPIDPS TLVKAEDIDA  360
YAPKDLLIVT TGSQAEPRAA LNLASYGSSH SFKLTKEDIV LYSAKVIPGN ESRVMEMLNR  420
ISDIGSTIIM GKNECLHTSG HAYRGELEEV LRIVKPQHFL PIHGELLFLK EHELLGKSTG  480
IRHTTVIKNG EMLGVSHLRN KRVLSNGFIS LGKENFQLMY SDGEKAFGTS SELFIDERMR  540
IALDGIIVIS MEIFRPQNLE SPVENTLKGK IRITTRCLWL DKGKLLDALH KAAHAALSSC  600
PASCPLAHME RIVSEVVRKM VRKYSGKRPE VIVIAVENPA AVLASEINMK LSGKFHMDGT  660
SALKKVVVGR GKENQRTKTQ IRERIDVGGI LPTEDIAISS GVEDDLSDAE NSDDFFKPLV  720
GSSPVEKSIK ANNGYVPQKE KPSPFKDGSS EDTEEECNSV NTSNSEPKSS KSAKKNKWKH  780
DEVKKLIGMR GEMNDRFQVV KGRMALWEEI SQNLLSNGIS RSPGQCKSLW TSLLQKYEQE  840
VKNEKNGKKK WPYLEEMERI LSDSETLASK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0v_B2e-877963719560RIBONUCLEASE J
5a0v_A2e-877963719560RIBONUCLEASE J
5a0t_B2e-877963719560RIBONUCLEASE J
5a0t_A2e-877963719560RIBONUCLEASE J
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155530.10.0hypothetical protein PHAVU_003G209600g
TrEMBLV7CBI80.0V7CBI8_PHAVU; Uncharacterized protein
STRINGGLYMA17G13780.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein